Structure of PDB 6puq Chain A

Receptor sequence

>6puqA (length=171) Species: 402676 (Schizosaccharomyces japonicus yFS275)

RKLTDISACSINIFYSTLGGSTQKFAEHVADRIRSSLQTELVEILNLDYI
DLDEYFSKGNSNTVYLVLLPSYAIESSIDYFLSALQTTIDDFRIVARPLE
KLRGFAVLGFGDFEQYAGDLFCYQAIAADQRLAKLGAQRIAPLGVVNVKL
EKAQVYEAMEAWTDLFLQYAK

3D structure

• PDB: 6puq Biochemical and structural characterization of the flavodoxin-like domain of the Schizosaccharomyces japonicus putative tRNAPhe 4-demethylwyosine synthase Tyw1 in complex with FMN.
• Chain: A
• Resolution: 1.56 Å

Enzymatic activity

• Enzyme Commision number: 4.1.3.44: tRNA 4-demethylwyosine synthase (AdoMet-dependent).

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	FMN	A	T94 L95 G96 S98 T99 P147 S148 Y149 A150 G188 D189 Y193 L197 F198 C199	T17 L18 G19 S21 T22 P70 S71 Y72 A73 G111 D112 Y116 L120 F121 C122
BS02	MG	A	T99 F102 F187	T22 F25 F110
BS03	MG	A	L146 P147 S148 G186 F187 C199	L69 P70 S71 G109 F110 C122
BS04	MG	A	A183 V184 L220	A106 V107 L143
BS05	MG	A	Y149 I151 S153 D156 Q201	Y72 I74 S76 D79 Q124
BS06	MG	A	S93 T94 N123 D125	S16 T17 N46 D48

Gene Ontology

Molecular Function

• GO:0009055 electron transfer activity
• GO:0010181 FMN binding
• GO:0051539 4 iron, 4 sulfur cluster binding

Biological Process

• GO:0008033 tRNA processing

External links

• PDB: RCSB:6puq, PDBe:6puq, PDBj:6puq
• PDBsum: 6puq
• PubMed: 35693892
• UniProt: B6K6D6