Structure of PDB 6p73 Chain A

Receptor sequence

>6p73A (length=439) Species: 70863 (Shewanella oneidensis)

SDKTEPRNEVYKDKFKNQYNSWHDTAKSEELVDALEQDPNMVILWAGYAF
AKDYKAPRGHMYAVTDVRNTLRTGAPKNAEDGPLPMACWSCKSPDVPRLI
EEQGEDGYFKGKWAKGGPEVTNTIGCSDCHEKGSPKLRISRPYVDRALDA
IGTPFSKASKQDKESMVCAQCHVEYYFEKKEDKKGFVKFPWDMGVTVDQM
EVYYDGIEFSDWTHALSKTPMLKAQHPEYETWKMGIHGKNNVSCVDCHMP
KVTSPEGKKFTDHKVGNPFDRFEETCATCHSQTKEFLVGVTNERKAKVKE
MKLKAEEQLVKAHFEAAKAWELGATEAEMKPILTDIRHAQWRWDLAIASH
GVAAHAPEEALRVLGTSVNKAADARVKLAQLLAKKGLTDPVAIPDISTKA
KAQAVLGMDMEKMNAEKEAFKKDMLPKWDAEAKKREATY

3D structure

• PDB: 6p73 Trapping of a Putative Intermediate in the CytochromecNitrite Reductase (ccNiR)-Catalyzed Reduction of Nitrite: Implications for the ccNiR Reaction Mechanism.
• Chain: A
• Resolution: 1.65 Å

Enzymatic activity

• Enzyme Commision number: 1.7.2.2: nitrite reductase (cytochrome; ammonia-forming).

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEC	A	K86 P88 D97 T101 R103 C119 C122 K123 C202 H203 Y206 H257	K55 P57 D66 T70 R72 C88 C91 K92 C171 H172 Y175 H226
BS02	HEC	A	F46 Q49 W53 G156 C157 C160 H161 P166 L168 M280 T292 H294	F15 Q18 W22 G125 C126 C129 H130 P135 L137 M249 T261 H263
BS03	HEC	A	S59 P88 R89 H91 Y93 A94 D97 C122 K123 I155 C199 C202 H203 H279 V296	S28 P57 R58 H60 Y62 A63 D66 C91 K92 I124 C168 C171 H172 H248 V265
BS04	HEC	A	H203 E259 W263 H268 S274 C275 C278 H279 N298 P299 K326 G382 A385 H386	H172 E228 W232 H237 S243 C244 C247 H248 N267 P268 K295 G351 A354 H355
BS05	HEC	A	I267 H268 V273 F300 T306 C307 C310 H311 R325	I236 H237 V242 F269 T275 C276 C279 H280 R294
BS06	CA	A	E205 Y206 K254 Q256	E174 Y175 K223 Q225
BS07	HEC	A	H311 Q313	H280 Q282

Gene Ontology

Molecular Function

• GO:0005506 iron ion binding
• GO:0005509 calcium ion binding
• GO:0016491 oxidoreductase activity
• GO:0020037 heme binding
• GO:0042279 nitrite reductase (cytochrome, ammonia-forming) activity
• GO:0046872 metal ion binding

Biological Process

• GO:0019645 anaerobic electron transport chain
• GO:0042128 nitrate assimilation

Cellular Component

• GO:0030288 outer membrane-bounded periplasmic space
• GO:0042597 periplasmic space

External links

• PDB: RCSB:6p73, PDBe:6p73, PDBj:6p73
• PDBsum: 6p73
• PubMed: 31381304
• UniProt: Q8EAC7|NRFA_SHEON Cytochrome c-552 (Gene Name=nrfA)