Structure of PDB 6p4r Chain A |
>6p4rA (length=114) Species: 220341 (Salmonella enterica subsp. enterica serovar Typhi str. CT18) [Search protein sequence] |
EWTGDKTNAYYSDEVISELHVGQIDTSPYFCIKTVKANGSGTPVVACAVS KQSIWAPSFKELLDQARYFYSTGQSVRIHVQKNIWTYPLFVNTFSANALV GLSSCSATQCFGPK |
|
PDB | 6p4r Salmonella Typhoid Toxin PltB Subunit and Its Non-typhoidal Salmonella Ortholog Confer Differential Host Adaptation and Virulence. |
Chain | A |
Resolution | 1.87 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
SIA |
A |
Y33 Y34 S35 K59 |
Y10 Y11 S12 K36 |
|
|
|
|