Structure of PDB 6p0s Chain A

Receptor sequence

>6p0sA (length=83) Species: 83333 (Escherichia coli K-12) [Search protein sequence]

SDVLTVSTQKPLRDSVKQALKNYFAQLNGQDVNDLYELVLAEVEQPLLDM
VMQYTRGNQTRAALMMGINRGTLRKKLKKYGMN

3D structure

PDB

6p0s Cooperative DNA binding by proteins through DNA shape complementarity.

Chain

Resolution

2.7 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	A	N84 T87	N69 T72
BS02	dna	A	N73 Q74 T75 R85 R89 N98	N58 Q59 T60 R70 R74 N83

Gene Ontology

	Molecular Function
GO:0000976	transcription cis-regulatory region binding
GO:0001046	core promoter sequence-specific DNA binding
GO:0001216	DNA-binding transcription activator activity
GO:0001217	DNA-binding transcription repressor activity
GO:0003677	DNA binding
GO:0003700	DNA-binding transcription factor activity
GO:0005515	protein binding
GO:0042803	protein homodimerization activity
GO:0043565	sequence-specific DNA binding
GO:0044374	sequence-specific DNA binding, bending

	Biological Process
GO:0006351	DNA-templated transcription
GO:0006355	regulation of DNA-templated transcription
GO:0009314	response to radiation
GO:0032359	provirus excision
GO:0045892	negative regulation of DNA-templated transcription
GO:0045893	positive regulation of DNA-templated transcription
GO:0045911	positive regulation of DNA recombination
GO:0051276	chromosome organization

External links

PDB	RCSB:6p0s, PDBe:6p0s, PDBj:6p0s
PDBsum	6p0s
PubMed	31616952
UniProt	P0A6R3\|FIS_ECOLI DNA-binding protein Fis (Gene Name=fis)