Structure of PDB 6ozm Chain A

Receptor sequence

>6ozmA (length=245) Species: 10090 (Mus musculus)

ERPPEETLSLWKGEQARLKARVVDRDTEAWQRDPSFSGLQKVGGVDVSFV
KGDSVRACASLVVLSYPELKVVYEDSRMVGLKAPYVSGFLAFREVPFLVE
LVQRLQEKEPDLMPQVVLVDGNGVLHQRGFGVACHLGVLTELPCIGVAKK
LLQVDGLENNALHKEKIVLLQAGGDTFPLIGSSGTVLGMALRSHDHSTKP
LYVSVGHRISLEVAVRLTHHCCRFRIPEPIRQADIRSREYIRRTL

3D structure

• PDB: 6ozm Evolution of Inosine-Specific Endonuclease V from Bacterial DNase to Eukaryotic RNase.
• Chain: A
• Resolution: 2.15 Å

Enzymatic activity

• Enzyme Commision number: 3.1.26.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	A	D52 S54 F55 Y91 S93 G94 L96 E100 D126 N128 H132 G137 V138 K155 K156 L158 Q159	D46 S48 F49 Y85 S87 G88 L90 E94 D120 N122 H126 G131 V132 K149 K150 L152 Q153
BS02	rna	A	H202 S203 T204 K205 F230 R231 R237 R244	H196 S197 T198 K199 F224 R225 R231 R238
BS03	MN	A	D52 D240	D46 D234
BS04	MN	A	D52 D126	D46 D120

Gene Ontology

Molecular Function

• GO:0004519 endonuclease activity

Biological Process

• GO:0006281 DNA repair

External links

• PDB: RCSB:6ozm, PDBe:6ozm, PDBj:6ozm
• PDBsum: 6ozm
• PubMed: 31444105
• UniProt: Q8C9A2|ENDOV_MOUSE Endonuclease V (Gene Name=Endov)