Structure of PDB 6ozj Chain A

Receptor sequence

>6ozjA (length=242) Species: 10090 (Mus musculus)

ERPPEETLSLWKGEQARLKARVVDRDTEAWQRDPSFSGLQKVGGVDVSFV
KSVRACASLVVLSYPELKVVYEDSRMVGLKAPYVSGFLAFREVPFLVELV
QRLQEKEPDLMPQVVLVDGNGVLHQRGFGVACHLGVLTELPCIGVAKKLL
QVDGLENNALHKEKIVLLQAGGDTFPLIGSSGTVLGMALRSHDHSTKPLY
VSVGHRISLEVAVRLTHHCCRFRIPEPIRQADIRSREYIRRT

3D structure

• PDB: 6ozj Evolution of Inosine-Specific Endonuclease V from Bacterial DNase to Eukaryotic RNase.
• Chain: A
• Resolution: 2.247 Å

Enzymatic activity

• Enzyme Commision number: 3.1.26.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	A	V53 S54 F55 K57 Y91 S93 G94 L96 D126 G127 N128 H132 G137 V138 A154 K155 K156 L158 Q159 R244	V47 S48 F49 K51 Y83 S85 G86 L88 D118 G119 N120 H124 G129 V130 A146 K147 K148 L150 Q151 R236
BS02	rna	A	K57 H202 S203 T204 K205 F230 R231 R237 R248	K51 H194 S195 T196 K197 F222 R223 R229 R240

Gene Ontology

Molecular Function

• GO:0004519 endonuclease activity

Biological Process

• GO:0006281 DNA repair

External links

• PDB: RCSB:6ozj, PDBe:6ozj, PDBj:6ozj
• PDBsum: 6ozj
• PubMed: 31444105
• UniProt: Q8C9A2|ENDOV_MOUSE Endonuclease V (Gene Name=Endov)