Structure of PDB 6ot3 Chain A

Receptor sequence

>6ot3A (length=357) Species: 562 (Escherichia coli)

PVNNRIQDLTERSDVLRGYLDYDAKKERLEEVNAELEQPDVWNEPERAQA
LGKERSSLEAVVDTLDQMKQGLEDVSGLLELAVEADDEETFNEAVAELDA
LEEKLAQLEFRRMFSGEYDSADCYLDIQAGSGGTEAQDWASMLERMYLRW
AESRGFKTEIIEESEGEVAGIKSVTIKISGDYAYGWLRTETGVHRLVRKS
PFDSGGRRHTSFSSAFVYPEVDDDIDIEINPADLRIDVYRTSGAGGQHVN
RTESAVRITHIPTGIVTQCQNDRSQHKNKDQAMKQMKAKLYELEMQKKNA
EKQAMEDNKSDIGWGSQIRSYVLDDSRIKDLRTGVETRNTQAVLDGSLDQ
FIEASLK

3D structure

• PDB: 6ot3 The structural basis for release-factor activation during translation termination revealed by time-resolved cryogenic electron microscopy.
• Chain: A
• Resolution: 3.9 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	A	W47 Q54 K58 R245 S247 A249 Q252 H253 V254 R256 T257 E258 R262 Q273 R278 Q280 Q308 E311	W42 Q49 K53 R240 S242 A244 Q247 H248 V249 R251 T252 E253 R257 Q268 R273 Q275 Q303 E306
BS02	rna	A	G135 S136 R150 R154 K204 R213 I317 W319 R332	G130 S131 R145 R149 K199 R208 I312 W314 R327
BS03	rna	A	G137 T139 E140 S205 R212 R213 H214 T215	G132 T134 E135 S200 R207 R208 H209 T210
BS04	rna	A	E172 D277 R278	E167 D272 R273

Gene Ontology

Molecular Function

• GO:0003747 translation release factor activity
• GO:0016149 translation release factor activity, codon specific

Biological Process

• GO:0006412 translation
• GO:0006415 translational termination
• GO:0075523 viral translational frameshifting

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol

External links

• PDB: RCSB:6ot3, PDBe:6ot3, PDBj:6ot3
• PDBsum: 6ot3
• PubMed: 31189921
• UniProt: P07012|RF2_ECOLI Peptide chain release factor RF2 (Gene Name=prfB)