Structure of PDB 6ora Chain A

Receptor sequence

>6oraA (length=299) Species: 70601 (Pyrococcus horikoshii OT3)

MDLVEEILRLKEERNAIILAHNYQLPEVQDIADFIGDSLELARRATRVDA
DVIVFAGVDFMAETAKILNPDKVVLIPSREATCAMANMLKVEHILEAKRK
YPNAPVVLYVNSTAEAKAYADVTVTSANAVEVVKKLDSDVVIFGPDKNLA
HYVAKMTGKKIIPVPSKGHCYVHQKFTLDDVERAKKLHPNAKLMIHPQCI
PEVQEKADIIASTGGMIKRACEWDEWVVFTEREMVYRLRKLYPQKKFYPA
REDAFCIGMKAITLKNIYESLKDMKYKVEVPEEIARKARKAIERMLEMS

3D structure

• PDB: 6ora An Unexpected Species Determined by X-ray Crystallography that May Represent an Intermediate in the Reaction Catalyzed by Quinolinate Synthase.
• Chain: A
• Resolution: 2.2 Å

Enzymatic activity

• Enzyme Commision number: 2.5.1.72: quinolinate synthase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	SF4	A	Y23 C83 A84 C170 Q198 C256	Y23 C83 A84 C170 Q198 C256
BS02	5XW	A	H21 D37 S38 L39 N111 T125 S126 A127 H196 Q198 S212 T213	H21 D37 S38 L39 N111 T125 S126 A127 H196 Q198 S212 T213
BS03	CL	A	R44 V48	R44 V48

Gene Ontology

Molecular Function

• GO:0008987 quinolinate synthetase A activity
• GO:0016740 transferase activity
• GO:0016765 transferase activity, transferring alkyl or aryl (other than methyl) groups
• GO:0046872 metal ion binding
• GO:0051539 4 iron, 4 sulfur cluster binding

Biological Process

• GO:0009435 NAD biosynthetic process
• GO:0019363 pyridine nucleotide biosynthetic process
• GO:0019805 quinolinate biosynthetic process
• GO:0034628 'de novo' NAD biosynthetic process from aspartate

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:6ora, PDBe:6ora, PDBj:6ora
• PDBsum: 6ora
• PubMed: 31390192
• UniProt: O57767|NADA_PYRHO Quinolinate synthase (Gene Name=nadA)