Structure of PDB 6ont Chain A |
>6ontA (length=121) Species: 401614 (Francisella tularensis subsp. novicida U112) [Search protein sequence] |
NPKVLVADDDKKIAQFIKTKFEENGIDTTVAFDGKEALFLINTNNYDVIV IDWMMPYLDGISLLKILRKQNINTPVIILSALDSTENKIEGLKSGSDDYL TKPFSIDELIIRVNILYKRTK |
|
PDB | 6ont Francisella novicidaTwo-Component System Response Regulator BfpR Modulates iglC Gene Expression, Antimicrobial Peptide Resistance, and Biofilm Production. |
Chain | A |
Resolution | 1.803 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CA |
A |
D11 D12 D56 M58 |
D8 D9 D52 M54 |
|
|
|
|