Structure of PDB 6on1 Chain A |
>6on1A (length=147) Species: 1957 (Streptomyces sclerotialus) [Search protein sequence] |
HAFRFHHIGVQTSDLENSLGWYREFFGCEQNWSLEKFSDLTRSRLPGITR LVELAAGDLRIHVFERAADATPAPVAEVPQFQHLCLATRSPEEMTEWRDR WLELYESGRYTFVRDEGPTDIVVDEDGVLSLYVLDVNGLEYEFTYLP |
|
PDB | 6on1 Crystal Structures of L-DOPA Dioxygenase fromStreptomyces sclerotialus. |
Chain | A |
Resolution | 1.982 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
FE |
A |
H95 E154 |
H83 E142 |
|
|
|
|