Structure of PDB 6ogs Chain A |
>6ogsA (length=99) Species: 11676 (Human immunodeficiency virus 1) [Search protein sequence] |
PQITLWQRPIVTIKVGGQLREALIDTGADDTILEEINLPGRWKPKLIGGI GGFIKVRQYDQIPIEICGHQAIGTVLVGPTPANVIGRNMLTQIGCTLNF |
|
PDB | 6ogs Single atom changes in newly synthesized HIV protease inhibitors reveal structural basis for extreme affinity, high genetic barrier, and adaptation to the HIV protease plasticity. |
Chain | A |
Resolution | 1.27 Å |
3D structure |
|
|
Catalytic site (original residue number in PDB) |
D25 T26 G27 |
Catalytic site (residue number reindexed from 1) |
D25 T26 G27 |
Enzyme Commision number |
? |
|
|
|
|