Structure of PDB 6ogh Chain A

Receptor sequence

>6oghA (length=121) Species: 7159 (Aedes aegypti)

FTVSTTEDLQRYRTECVSSLNIPADYVEKFKKWEFPEDDTTMCYIKCVFN
KMQLFDDTEGPLVDNLVHQLAHGRDAEEVRTEVLKCVDKNTDNNACHWAF
RGFKCFQKNNLSLIKASIKKD

3D structure

• PDB: 6ogh Aedes aegypti Odorant Binding Protein 22 selectively binds fatty acids through a conformational change in its C-terminal tail.
• Chain: A
• Resolution: 1.85 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	CO	A	H74 D123	H72 D121
BS02	EIC	A	R15 F37 Y46 F51 M54 C88 G104 F108	R13 F35 Y44 F49 M52 C86 G102 F106

Gene Ontology

Molecular Function

• GO:0005549 odorant binding
• GO:0008289 lipid binding

Biological Process

• GO:0007608 sensory perception of smell

Cellular Component

• GO:0005576 extracellular region
• GO:0005615 extracellular space

External links

• PDB: RCSB:6ogh, PDBe:6ogh, PDBj:6ogh
• PDBsum: 6ogh
• PubMed: 32094450
• UniProt: Q1HRL7