Structure of PDB 6oes Chain A

Receptor sequence

>6oesA (length=548) Species: 10090 (Mus musculus) [Search protein sequence]

GLQPAVCLAIRVNTFLSCSQYHKMYRTVKAITGRQIFQPLHALRNAEKVL
LPGYHPFEWQPPLKNVSSRTDVGIIDGLSGLASSVDEYPVDTIAKRFRYD
SALVSALMDMEEDILEGMRSQDLDDYLNGPFTVVVKESCDGMGDVSEKHG
SGPAVPEKAVRFSFTVMRITIEHGSQNVKVFEEPKPNSELCCKPLCLMLA
DESDHETLTAILSPLIAEREAMKSSELTLEMGGIPRTFKFIFRGTGYDEK
LVREVEGLEASGSVYICTLCDTTRLEASQNLVFHSITRSHAENLQRYEVW
RSNPYHESVEELRDRVKGVSAKPFIETVPSIDALHCDIGNAAEFYKIFQL
EIGEVYKHPNASKEERKRWQATLDKHLRKRMNLKPIMRMNGNFARKLMTQ
ETVDAVCELIPSEERHEALRELMDLYLKMKPVWRSSCPAKECPESLCQYS
FNSQRFAELLSTKFKYRYEGKITNYFHKTLAHVPEIIERDGSIGAWASEG
NQSGNKLFRRFRKMNARQSKCYEMEDVLKHHWLYTSKYLQKFMNAHNA

3D structure

PDB

6oes How mouse RAG recombinase avoids DNA transposition.

Chain

Resolution

3.06 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

2.3.2.27: RING-type E3 ubiquitin transferase.
3.1.-.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	dna	A	K618 L794 H795 R848 G851 N852 E959 Q962 K966 R969	K158 L334 H335 R388 G391 N392 E499 Q502 K506 R509
BS02	dna	A	D708 E709 S721 H795 T933 N934 Y935	D248 E249 S261 H335 T473 N474 Y475
BS03	dna	A	Y485 K489 H501 K608 H609 G610 A720 G722 S723 R773 M847 Q978	Y25 K29 H41 K148 H149 G150 A260 G262 S263 R313 M387 Q518
BS04	dna	A	K645 S648 E649 R855 P891 R894 S895 E901 E959	K185 S188 E189 R395 P431 R434 S435 E441 E499
BS05	dna	A	S477 C478 S479 Q480 K483 R504 M974 N975 A976 R977 K989	S17 C18 S19 Q20 K23 R44 M514 N515 A516 R517 K529
BS06	CA	A	D600 G601	D140 G141
BS07	ZN	A	C727 H937 H942	C267 H477 H482

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0004519	endonuclease activity
GO:0004842	ubiquitin-protein transferase activity
GO:0005515	protein binding
GO:0008270	zinc ion binding
GO:0016740	transferase activity
GO:0042393	histone binding
GO:0042802	identical protein binding
GO:0042803	protein homodimerization activity
GO:0043565	sequence-specific DNA binding
GO:0046872	metal ion binding
GO:0061630	ubiquitin protein ligase activity

	Biological Process
GO:0002250	adaptive immune response
GO:0002331	pre-B cell allelic exclusion
GO:0006310	DNA recombination
GO:0006325	chromatin organization
GO:0008542	visual learning
GO:0030183	B cell differentiation
GO:0033077	T cell differentiation in thymus
GO:0033151	V(D)J recombination
GO:0043029	T cell homeostasis
GO:0045580	regulation of T cell differentiation
GO:0045582	positive regulation of T cell differentiation
GO:0048538	thymus development
GO:0051865	protein autoubiquitination
GO:0070233	negative regulation of T cell apoptotic process
GO:0070244	negative regulation of thymocyte apoptotic process
GO:2000822	regulation of behavioral fear response

	Cellular Component
GO:0005634	nucleus
GO:0005654	nucleoplasm

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6oes, PDBe:6oes, PDBj:6oes
PDBsum	6oes
PubMed	32015553
UniProt	P15919\|RAG1_MOUSE V(D)J recombination-activating protein 1 (Gene Name=Rag1)

[Back to BioLiP]