Structure of PDB 6o5x Chain A |
>6o5xA (length=99) Species: 11676 (Human immunodeficiency virus 1) [Search protein sequence] |
PQITLWQRPIVTIKIGGQLREALLDTGADDTVLEDIDLPGRWKPKLIVGI GGFVKVRQYEQVPIEIAGHKVVGTVLIGPTPSNIIGRNLMTQLGATLNF |
|
PDB | 6o5x Highly Drug-Resistant HIV-1 Protease Mutant PRS17 Shows Enhanced Binding to Substrate Analogues. |
Chain | A |
Resolution | 1.7 Å |
3D structure |
|
|
Catalytic site (original residue number in PDB) |
D25 T26 G27 |
Catalytic site (residue number reindexed from 1) |
D25 T26 G27 |
Enzyme Commision number |
? |
|
|
|
|