Structure of PDB 6nuf Chain A

Receptor sequence

>6nufA (length=360) Species: 9606 (Homo sapiens)

LSTTDRVVKAVPFPPSHRLTAKEVFDNDGKPRVDILKAHLMKEGRLEESV
ALRIITEGASILRQEKNLLDIDAPVTVCGDIHGQFFDLMKLFEVGGSPAN
TRYLFLGDYVDRGYFSIECVLYLWALKILYPKTLFLLRGNHECRHLTEYF
TFKQECKIKYSERVYDACMDAFDCLPLAALMNQQFLCVHGGLSPEINTLD
DIRKLDRFKEPPAYGPMCDILWSDPLEDFGNEKTQEHFTHNTVRGCSYFY
SYPAVCEFLQHNNLLSILRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPN
YLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEK
VTEMLVNVLN

3D structure

• PDB: 6nuf Molecular basis for the binding and selective dephosphorylation of Na+/H+exchanger 1 by calcineurin.
• Chain: A
• Resolution: 1.9 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): D90 H92 D118 D121 R122 N150 H151 H199 R254 H281
• Catalytic site (residue number reindexed from 1): D80 H82 D108 D111 R112 N140 H141 H189 R244 H271
• Enzyme Commision number: 3.1.3.16: protein-serine/threonine phosphatase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	A	Y288 T297 G298 F299 N327 V328 M329 N330 I331 Q333 W352 S353 F356 E359 K360	Y278 T287 G288 F289 N317 V318 M319 N320 I321 Q323 W342 S343 F346 E349 K350
BS02	FE	A	D90 H92 D118	D80 H82 D108
BS03	ZN	A	D118 N150 H199 H281	D108 N140 H189 H271

Gene Ontology

Molecular Function

• GO:0016787 hydrolase activity
• GO:0033192 calmodulin-dependent protein phosphatase activity

Biological Process

• GO:0097720 calcineurin-mediated signaling

External links

• PDB: RCSB:6nuf, PDBe:6nuf, PDBj:6nuf
• PDBsum: 6nuf
• PubMed: 31375679
• UniProt: Q08209|PP2BA_HUMAN Protein phosphatase 3 catalytic subunit alpha (Gene Name=PPP3CA)