Structure of PDB 6nud Chain A |
>6nudA (length=108) Species: 1308 (Streptococcus thermophilus) [Search protein sequence] |
KAERAISLLEKDNKGNYLLTTSQIRKLLSLCSSLYDRSKERKFDELINDV SYLRVQFVYQAGREIAVKDLIEKAQILEALKEIKDRETLQRFCRYMEALV AYFKFYGG |
|
PDB | 6nud Coupling of ssRNA cleavage with DNase activity in type III-A CRISPR-Csm revealed by cryo-EM and biochemistry. |
Chain | A |
Resolution | 3.5 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
rna |
A |
T31 S33 Q34 |
T20 S22 Q23 |
|
|
|
|