Structure of PDB 6nu6 Chain A

Receptor sequence
>6nu6A (length=227) Species: 83332 (Mycobacterium tuberculosis H37Rv) [Search protein sequence]
GGTILVVTGTGTGVGKTVVCAALASAARQAGIDVAVCKPVQTGTARGDDD
LAEVGRLAGVTQLAGLARYPQPMAPAAAAEHAGMALPARDQIVRLIADLD
RPGRLTLVEGAGGLLVELAEPGVTLRDVAVDVAAAALVVVTADLGTLNHT
KLTLEALAAQQVSCAGLVIGSWPDPPGLVAASNRSALARIAMVRAALPAG
AASLDAGDFAAMSAAAFDRNWVAGLVG
3D structure
PDB6nu6 Crystal structure of Mycobacterium tuberculosis dethiobiotin synthetase in complex with fragment analogue 5
ChainA
Resolution2.437 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) T11 G12 K15 T16 K37 T41 G54 E108
Catalytic site (residue number reindexed from 1) T12 G13 K16 T17 K38 T42 G55 E109
Enzyme Commision number 6.3.3.3: dethiobiotin synthase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 L1V A T11 K15 P71 M72 G111 V115 T12 K16 P72 M73 G112 V116
BS02 L1Y A T11 K15 T41 R45 P71 M72 A73 A110 G111 V115 T12 K16 T42 R46 P72 M73 A74 A111 G112 V116
BS03 L1V A L143 G144 L146 N147 L144 G145 L147 N148
BS04 L1Y A L143 G144 L146 N147 L144 G145 L147 N148
Gene Ontology
Molecular Function
GO:0000287 magnesium ion binding
GO:0004141 dethiobiotin synthase activity
GO:0005524 ATP binding
GO:0016874 ligase activity
GO:0046872 metal ion binding
Biological Process
GO:0009102 biotin biosynthetic process
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6nu6, PDBe:6nu6, PDBj:6nu6
PDBsum6nu6
PubMed
UniProtP9WPQ5|BIOD_MYCTU Dethiobiotin synthetase BioD (Gene Name=bioD)

[Back to BioLiP]