Structure of PDB 6nt8 Chain A

Receptor sequence

>6nt8A (length=294) Species: 9031 (Gallus gallus) [Search protein sequence]

PARLLIPEPRAGRARHAACVLLAVCFVVLFLAPIIRSVCTQLAALQLGVL
LKGCCCLAEEIFHLHSRHHLWQVLCSCFPPRWYLALLLVGGSLTLSCLCQ
LLVLALGLQKLSAVEVSELTESSKKNVAHGLAWSYYIGYLKVVLPRLKEC
MEELSRTHRDTWKLHILVPLGCDIWDDLEKADSNIQYLADLPETILTRAG
IKRRVYKHSLYVIRDLRPCVLEFASPLQTLCAMSQDDCAAFSREQRLEQA
RLFYRSLRDILGSSKECAGLYRLIAYEEPHFLSGLILWHLQQQQ

3D structure

PDB

6nt8 Cryo-EM structures of STING reveal its mechanism of activation by cyclic GMP-AMP.

Chain

Resolution

6.5 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	1SY	A	Y172 R243	Y139 R204

Gene Ontology

	Molecular Function
GO:0000166	nucleotide binding
GO:0015252	proton channel activity
GO:0035438	cyclic-di-GMP binding
GO:0042803	protein homodimerization activity
GO:0061507	2',3'-cyclic GMP-AMP binding

	Biological Process
GO:0000045	autophagosome assembly
GO:0002218	activation of innate immune response
GO:0006914	autophagy
GO:0016239	positive regulation of macroautophagy
GO:0032481	positive regulation of type I interferon production
GO:0032728	positive regulation of interferon-beta production
GO:0034220	monoatomic ion transmembrane transport
GO:0045087	innate immune response
GO:0051259	protein complex oligomerization
GO:0051607	defense response to virus
GO:0061709	reticulophagy
GO:0140896	cGAS/STING signaling pathway
GO:1902600	proton transmembrane transport

	Cellular Component
GO:0000139	Golgi membrane
GO:0000421	autophagosome membrane
GO:0005737	cytoplasm
GO:0005776	autophagosome
GO:0005783	endoplasmic reticulum
GO:0005789	endoplasmic reticulum membrane
GO:0005794	Golgi apparatus
GO:0016020	membrane
GO:0031410	cytoplasmic vesicle
GO:0033116	endoplasmic reticulum-Golgi intermediate compartment membrane
GO:0048471	perinuclear region of cytoplasm

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6nt8, PDBe:6nt8, PDBj:6nt8
PDBsum	6nt8
PubMed	30842659
UniProt	E1C7U0\|STING_CHICK Stimulator of interferon genes protein (Gene Name=STING1)

[Back to BioLiP]