Structure of PDB 6nog Chain A

Receptor sequence
>6nogA (length=96) Species: 8355 (Xenopus laevis) [Search protein sequence]
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSS
AVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGE
3D structure
PDB6nog Mechanism of Cross-talk between H2B Ubiquitination and H3 Methylation by Dot1L.
ChainA
Resolution3.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna A G44 R49 R63 L65 R83 G7 R12 R26 L28 R46
BS02 dna A R42 R72 R83 F84 Q85 R116 V117 T118 R5 R35 R46 F47 Q48 R79 V80 T81
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005694 chromosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:6nog, PDBe:6nog, PDBj:6nog
PDBsum6nog
PubMed30765112
UniProtP84233|H32_XENLA Histone H3.2

[Back to BioLiP]