Structure of PDB 6nma Chain A |
>6nmaA (length=115) Species: 386891 (Moraxella bovoculi) [Search protein sequence] |
MYLVVQALIRACIIKEIDLYTEQLYNIIKSLPYDKRPNVVYSDQPLDPNN LDLSEPELWAEQVGECMRYAHNDQPCFYIGSTKRELRVNYIVPVIGVRDE IERVMTLEEVRNLHK |
|
PDB | 6nma Structural Basis for the Inhibition of CRISPR-Cas12a by Anti-CRISPR Proteins. |
Chain | A |
Resolution | 3.38 Å |
3D structure |
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
rna |
A |
E184 M186 T201 |
E65 M67 T82 |
|
|
|