Structure of PDB 6nem Chain A

Receptor sequence

>6nemA (length=200) Species: 655278 (Influenza A virus (A/Luxembourg/43/2009(H1N1)))

GPLGSMEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVC
FMYSDFHFIDERGESIIVESGDPNALLKHRFEIIEGRDRIMAWTVVNSIC
NTTGVEKPKFLPDLYDYKENRFIEIGVTRREVHIYYLEKANKIKSEKTHI
HIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQEMASRSLWDSFRQSE

3D structure

• PDB: 6nem Aryl and Arylalkyl Substituted 3-Hydroxypyridin-2(1H)-ones: Synthesis and Evaluation as Inhibitors of Influenza A Endonuclease.
• Chain: A
• Resolution: 1.95 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	MN	A	H41 D108 E119 I120	H46 D113 E124 I125
BS02	MN	A	E80 D108	E85 D113
BS03	KKS	A	A20 Y24 K34 A37 I38 H41 E80 D108 E119 R124 K134	A25 Y29 K39 A42 I43 H46 E85 D113 E124 R129 K139	MOAD: ic50=12nM PDBbind-CN: -logKd/Ki=7.92,IC50=12nM

Gene Ontology

Molecular Function

• GO:0003723 RNA binding

Biological Process

• GO:0039694 viral RNA genome replication

External links

• PDB: RCSB:6nem, PDBe:6nem, PDBj:6nem
• PDBsum: 6nem
• PubMed: 30983160
• UniProt: C6H0Y9