Structure of PDB 6n9m Chain A

Receptor sequence

>6n9mA (length=331) Species: 99287 (Salmonella enterica subsp. enterica serovar Typhimurium str. LT2)

MIDITLPLTDIHRHLDGNIRAQTILDLGRQFNIALPAQTLETLIPHVQVT
STEPDLVSFLTKLDWGVKVLASLDACRRVAFENIEDAARNGLHYVELRFS
PGYMAMAHQLPIAGVVEAVIDGVRDGCNTFGVEARLIGIMSRTFGEAACL
QELDALLAHRENITALDLAGDELGFPGSLFLSHFNRARDAGWHITVHAGE
AAGPESIWQAIRELGAERIGHGVKAVEDRALMDFLAQQRIGIESCLTSNI
QTSTVASLADHPLKTFLEHGVLASLNTDDPAVQGVDIIHEYHVAAPAAGL
SREQIRQAQINGLEIAFLSDSEKRALREKVA

3D structure

• PDB: 6n9m Crystal Structure of Adenosine Deaminase from Salmonella typhimurium Complexed with Pentostatin (Deoxycoformycin) (CASP target)
• Chain: A
• Resolution: 1.449 Å

Enzymatic activity

• Enzyme Commision number: 3.5.4.4: adenosine deaminase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	DCF	A	H14 D16 L56 L60 S141 A169 G170 H197 E200 H221 D278 D279	H14 D16 L56 L60 S141 A169 G170 H197 E200 H221 D278 D279
BS02	ZN	A	H12 H14 H197 D278	H12 H14 H197 D278
BS03	CA	A	G131 E133	G131 E133

Gene Ontology

Molecular Function

• GO:0004000 adenosine deaminase activity
• GO:0008270 zinc ion binding
• GO:0016787 hydrolase activity
• GO:0019239 deaminase activity
• GO:0046872 metal ion binding
• GO:0046936 2'-deoxyadenosine deaminase activity

Biological Process

• GO:0006154 adenosine catabolic process
• GO:0009117 nucleotide metabolic process
• GO:0009168 purine ribonucleoside monophosphate biosynthetic process
• GO:0043103 hypoxanthine salvage
• GO:0046103 inosine biosynthetic process

Cellular Component

• GO:0005829 cytosol

External links

• PDB: RCSB:6n9m, PDBe:6n9m, PDBj:6n9m
• PDBsum: 6n9m
• UniProt: Q8ZPL9|ADD_SALTY Adenosine deaminase (Gene Name=add)