Structure of PDB 6n97 Chain A

Receptor sequence

>6n97A (length=260) Species: 83333 (Escherichia coli K-12)

AYQYVNVVTINKVAVIEFNYGRKLNALSKVFIDDLMQALSDLNRPEIRCI
ILRAPSGSKVFSAGHDIHELPSGGRDPLSYDDPLRQITRMIQKFPKPIIS
MVEGSVWGGAFEMIMSSDLIIAASTSTFSMTPVNLGVPYNLVGIHNLTRD
AGFHIVKELIFTASPITAQRALAVGILNHVVEVEELEDFTLQMAHHISEK
APLAIAVIKEELRVLGEAHTMNSDEFERIQGMRRAVYDSEDYQEGMNAFL
EKRKPNFVGH

3D structure

• PDB: 6n97 Sulfonate/Nitro Bearing Methylmalonyl-Thioester Isosteres Applied to Methylmalonyl-CoA Decarboxylase Structure-Function Studies.
• Chain: A
• Resolution: 1.75 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): H66 L71 G110 E113 P133 V138 Y140 E228 Y238
• Catalytic site (residue number reindexed from 1): H65 L70 G109 E112 P132 V137 Y139 E227 Y237
• Enzyme Commision number: 4.1.1.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	YZS	A	L25 K60 A64 H66 D67 I68 W108 G109 G110 T132 P133 L136 Y140 F250 K253	L24 K59 A63 H65 D66 I67 W107 G108 G109 T131 P132 L135 Y139 F249 K252	MOAD: Ki=7.1uM
BS02	KGP	A	L25 K60 A64 H66 D67 I68 W108 G109 G110 T132 P133 L136 Y140 F250 K253	L24 K59 A63 H65 D66 I67 W107 G108 G109 T131 P132 L135 Y139 F249 K252	MOAD: Ki=7.1uM PDBbind-CN: -logKd/Ki=5.15,Ki=7.1uM

Gene Ontology

Molecular Function

• GO:0003824 catalytic activity
• GO:0004492 methyl/ethyl malonyl-CoA decarboxylase activity
• GO:0016829 lyase activity
• GO:0016831 carboxy-lyase activity

Biological Process

• GO:0006635 fatty acid beta-oxidation

Cellular Component

• GO:0005829 cytosol

External links

• PDB: RCSB:6n97, PDBe:6n97, PDBj:6n97
• PDBsum: 6n97
• PubMed: 30869886
• UniProt: P52045|SCPB_ECOLI Methylmalonyl-CoA decarboxylase (Gene Name=scpB)