Structure of PDB 6n91 Chain A

Receptor sequence

>6n91A (length=334) Species: 243277 (Vibrio cholerae O1 biovar El Tor str. N16961)

MITSSLPLTDLHRHLDGNIRTQTILELGQKFGVKLPANTLQTLTPYVQIV
EAEPSLVAFLSKLDWGVAVLGDLDACRRVAYENVEDALNARIDYAELRFS
PYYMAMKHSLPVTGVVEAVVDGVRAGVRDFGIQANLIGIMSRTFGTDACQ
QELDAILSQKNHIVAVDLAGDELGQPGDRFIQHFKQVRDAGLHVTVHAGE
AAGPESMWQAIRDLGATRIGHGVKAIHDPKLMDYLAQHRIGIESCLTSNL
QTSTVDSLATHPLKRFLEHGILACINTDDPAVEGIELPYEYEVAAPQAGL
SQEQIRQAQLNGLELAFLSDSEKKALLAKAALRG

3D structure

• PDB: 6n91 Crystal Structure of Adenosine Deaminase from Vibrio cholerae Complexed with Pentostatin (Deoxycoformycin) (CASP target)
• Chain: A
• Resolution: 2.05 Å

Enzymatic activity

• Enzyme Commision number: 3.5.4.4: adenosine deaminase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	DCF	A	H14 D16 L56 L60 S141 A169 G170 H197 E200 H221 D278 D279	H14 D16 L56 L60 S141 A169 G170 H197 E200 H221 D278 D279
BS02	ZN	A	H12 H14 H197 D278	H12 H14 H197 D278

Gene Ontology

Molecular Function

• GO:0004000 adenosine deaminase activity
• GO:0008270 zinc ion binding
• GO:0016787 hydrolase activity
• GO:0019239 deaminase activity
• GO:0046872 metal ion binding
• GO:0046936 2'-deoxyadenosine deaminase activity

Biological Process

• GO:0006154 adenosine catabolic process
• GO:0009117 nucleotide metabolic process
• GO:0009168 purine ribonucleoside monophosphate biosynthetic process
• GO:0043103 hypoxanthine salvage
• GO:0046103 inosine biosynthetic process

Cellular Component

• GO:0005829 cytosol

External links

• PDB: RCSB:6n91, PDBe:6n91, PDBj:6n91
• PDBsum: 6n91
• UniProt: Q9KNI7|ADD_VIBCH Adenosine deaminase (Gene Name=add)