Structure of PDB 6n43 Chain A

Receptor sequence

>6n43A (length=185) Species: 9606 (Homo sapiens)

VLKPRTLADLIRILHQLFAGDEVNVEEVQAIMEAYESDPTEWAMYAKFDQ
YRYTRNLVDQGNGKFNLMILCWGEGHGSSIHDHTNSHCFLKMLQGNLKET
LFAWPDKKSNEMVKKSERVLRENQCAYINDSVGLHRVENISHTEPAVSLH
LYSPPFDTCHAFDQRTGHKNKVTMTFHSKFGIRTP

3D structure

• PDB: 6n43 Probing the Cys-Tyr Cofactor Biogenesis in Cysteine Dioxygenase by the Genetic Incorporation of Fluorotyrosine.
• Chain: A
• Resolution: 2.289 Å

Enzymatic activity

• Enzyme Commision number: 1.13.11.20: cysteine dioxygenase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	CYS	A	R60 H86 H88 H140 Y157 M179	R55 H81 H83 H135 Y152 M174
BS02	FE	A	H86 H88 H140	H81 H83 H135
BS03	NO	A	H88 C93 H140 H155 Y157	H83 C88 H135 H150 Y152

Gene Ontology

Molecular Function

• GO:0005506 iron ion binding
• GO:0008198 ferrous iron binding
• GO:0008270 zinc ion binding
• GO:0016151 nickel cation binding
• GO:0016702 oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen
• GO:0017172 cysteine dioxygenase activity
• GO:0046872 metal ion binding
• GO:0051213 dioxygenase activity

Biological Process

• GO:0000097 sulfur amino acid biosynthetic process
• GO:0006534 cysteine metabolic process
• GO:0006954 inflammatory response
• GO:0007595 lactation
• GO:0019448 L-cysteine catabolic process
• GO:0033762 response to glucagon
• GO:0042412 taurine biosynthetic process
• GO:0043200 response to amino acid
• GO:0045471 response to ethanol
• GO:0051384 response to glucocorticoid
• GO:0051591 response to cAMP

Cellular Component

• GO:0005829 cytosol

External links

• PDB: RCSB:6n43, PDBe:6n43, PDBj:6n43
• PDBsum: 6n43
• PubMed: 30946568
• UniProt: Q16878|CDO1_HUMAN Cysteine dioxygenase type 1 (Gene Name=CDO1)