Structure of PDB 6mxz Chain A |
>6mxzA (length=119) Species: 9606 (Homo sapiens) [Search protein sequence] |
SFVGLRVVAKWSSNGYFYSGKITRDVGAGKYKLLFDDGYECDVLGKDILL CDPIPLDTEVTALSEDEYFSAGVVKGHRKESGELYYSIEKEGQRKWYKRM AVILSLEQGNRLREQYGLG |
|
PDB | 6mxz An autoinhibited state of 53BP1 revealed by small molecule antagonists and protein engineering. |
Chain | A |
Resolution | 2.5 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
K6S |
A |
W1495 D1521 Y1523 M1584 |
W11 D37 Y39 M100 |
BindingDB: IC50=14000nM |
|
|