Structure of PDB 6muo Chain A

Receptor sequence
>6muoA (length=99) Species: 9606 (Homo sapiens) [Search protein sequence]
SRRRQGWLKEIRKLQKSTHLLIRKLPFSRLAREICVKFTRGVDFNWQAQA
LLALQEAAEAFLVHLFEDAYLLTLHAGRVTLFPKDVQLARRIRGLEEGL
3D structure
PDB6muo Structure of the Human Core Centromeric Nucleosome Complex.
ChainA
Resolution3.6 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna A R72 N85 W86 Q87 R118 V119 T120 R32 N45 W46 Q47 R78 V79 T80
BS02 dna A G46 R63 K64 L65 G6 R23 K24 L25
BS03 peptide A Q127 R130 R131 L135 L139 Q87 R90 R91 L95 L99
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:6muo, PDBe:6muo, PDBj:6muo
PDBsum6muo
PubMed31353180
UniProtP49450|CENPA_HUMAN Histone H3-like centromeric protein A (Gene Name=CENPA)

[Back to BioLiP]