Structure of PDB 6mpz Chain A

Receptor sequence
>6mpzA (length=142) Species: 1410622 (Lachnospiraceae bacterium C6A11) [Search protein sequence]
QIQPVTRGRAKVPVIMQMEALECGAASLAMVLAYYKKWVPLEQVRVDCGV
SRDGSNALNVLKAARNYGLEAKGYRYEPEKLKKEGTFPCIIHWNFNHFVV
LKGFKGKYAYINDPAKGDVKIPMEEFDRSFTGICLIFKPTDR
3D structure
PDB6mpz Insights into AMS/PCAT transporters from biochemical and structural characterization of a double Glycine motif protease.
ChainA
Resolution2.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 peptide A A24 L25 C27 G58 S59 N60 A61 L62 G77 Y78 R79 H96 N100 H101 F102 A20 L21 C23 G54 S55 N56 A57 L58 G73 Y74 R75 H92 N96 H97 F98
Gene Ontology
--> -->
 
 
UnboundLocalError
Python 3.6.8: /usr/bin/python3
Thu Feb 20 21:05:49 2025

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '6mpz', asym_id = 'A', title = 'Insights into AMS/PCAT transporters from biochem...racterization of a double Glycine motif protease.'
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='6mpz', asym_id='A', title='Insights into AMS/PCAT transporters from biochem...racterization of a double Glycine motif protease.')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0005524,0006508,0008233,0016020', uniprot = '', pdbid = '6mpz', asym_id = 'A'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0005524,0006508,0008233,0016020', uniprot='', pdbid='6mpz', asym_id='A')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>