Structure of PDB 6mke Chain A

Receptor sequence

>6mkeA (length=117) Species: 5763 (Naegleria fowleri)

TDWIPISQDQRLKKKIITAGSSDEQPPIGSKVSVHYTGTLTSGKKFDSSL
DRGQPFVFTLGKGEVIRGWDLGVKSMKKGEKSYFEIPSDYAYGNNAIPGL
IPANSTLMFEIELLSWK

3D structure

• PDB: 6mke Crystal Structure of Peptidylprolyl Isomerase from Naegleria fowleri with bound FK506
• Chain: A
• Resolution: 2.05 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): Y38 F48 D49 I68 Y94 F111
• Catalytic site (residue number reindexed from 1): Y36 F46 D47 I66 Y92 F109
• Enzyme Commision number: 5.2.1.8: peptidylprolyl isomerase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	FK5	A	Y38 D49 R54 F58 V67 I68 W71 Y94	Y36 D47 R52 F56 V65 I66 W69 Y92
BS02	FK5	A	P100 L102	P98 L100

Gene Ontology

Molecular Function

• GO:0003755 peptidyl-prolyl cis-trans isomerase activity
• GO:0016853 isomerase activity

Biological Process

• GO:0000413 protein peptidyl-prolyl isomerization

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:6mke, PDBe:6mke, PDBj:6mke
• PDBsum: 6mke
• UniProt: A0A2H4A315