Structure of PDB 6mht Chain A

Receptor sequence

>6mhtA (length=327) Species: 726 (Haemophilus haemolyticus)

MIEIKDKQLTGLRFIDLFAGLGGFRLALESCGAECVYSNEWDKYAQEVYE
MNFGEKPEGDITQVNEKTIPDHDILCAGFPCQAFSISGKQKGFEDSRGTL
FFDIARIVREKKPKVVFMENVKNFASHDNGNTLEVVKNTMNELDYSFHAK
VLNALDYGIPQKRERIYMICFRNDLNIQNFQFPKPFELNTFVKDLLLPDS
EVEHLVIDRKDLVMTNQEIEQTTPKTVRLGIVGKGGQGERIYSTRGIAIT
LSAYGGGIFAKTGGYLVNGKTRKLHPRECARVMGYPDSYKVHPSTSQAYK
QFGNSVVINVLQYIAYNIGSSLNFKPY

3D structure

• PDB: 6mht DNA containing 4'-thio-2'-deoxycytidine inhibits methylation by HhaI methyltransferase.
• Chain: A
• Resolution: 2.05 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): C81 E119 R163 R165
• Catalytic site (residue number reindexed from 1): C81 E119 R163 R165
• Enzyme Commision number: 2.1.1.37: DNA (cytosine-5-)-methyltransferase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	A	I86 S126 G236 Q237 E239 G257 S296	I86 S126 G236 Q237 E239 G257 S296	PDBbind-CN: Kd=21nM
BS02	dna	A	F79 C81 S85 S87 K89 R97 E119 V121 R165 R228 Q237 R240 Y242 T250 A253 Y254 G303 N304	F79 C81 S85 S87 K89 R97 E119 V121 R165 R228 Q237 R240 Y242 T250 A253 Y254 G303 N304	PDBbind-CN: Kd=21nM
BS03	SAM	A	F18 A19 G23 E40 W41 D60 I61 N304 S305	F18 A19 G23 E40 W41 D60 I61 N304 S305

Gene Ontology

Molecular Function

• GO:0003677 DNA binding
• GO:0003886 DNA (cytosine-5-)-methyltransferase activity
• GO:0008168 methyltransferase activity

Biological Process

• GO:0009307 DNA restriction-modification system
• GO:0032259 methylation

External links

• PDB: RCSB:6mht, PDBe:6mht, PDBj:6mht
• PDBsum: 6mht
• PubMed: 9207024
• UniProt: P05102|MTH1_HAEPH Type II methyltransferase M.HhaI (Gene Name=hhaIM)