Structure of PDB 6mhf Chain A

Receptor sequence

>6mhfA (length=330) Species: 10116 (Rattus norvegicus) [Search protein sequence]

LVPRGSHMDGEKAAKEVKLLLLGAGESGKSTIVKQMKIIHEDGYSEDECK
QYKVVVYSNTIQSIIAIIRAMGRLKIDFGEAARADDARQLFVLAGSAEEG
VMTSELAGVIKRLWRDGGVQACFSRSREYQLNDSASYYLNDLDRISQTNY
IPTQQDVLRTRVKTTGIVETHFTFKELYFKMFDVGGQRSERKKWIHCFEG
VTAIIFCVALSDYDLVLAEDEEMNRMHESMKLFDSICNNKWFTDTSIILF
LNKKDLFEEKIKRSPLTICYPEYTGSNTYEEAAAYIQCQFEDLNRRKDTK
EVYTHFTCATDTKNVQFVFDAVTDVIIKNN

3D structure

PDB

6mhf Structural basis for GPCR-independent activation of heterotrimeric Gi proteins.

Chain

Resolution

2.0 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	A	Q204 R205 S206 E207 R208 K209 W211 I212 F215 S252 N256 K257 W258	Q187 R188 S189 E190 R191 K192 W194 I195 F198 S235 N239 K240 W241
BS02	GDP	A	E43 S44 G45 K46 S47 T48 S151 R176 R178 N269 K270 D272 L273 C325 A326 T327	E26 S27 G28 K29 S30 T31 S134 R159 R161 N252 K253 D255 L256 C308 A309 T310

Gene Ontology

	Molecular Function
GO:0001664	G protein-coupled receptor binding
GO:0003924	GTPase activity
GO:0005515	protein binding
GO:0005525	GTP binding
GO:0019001	guanyl nucleotide binding
GO:0019003	GDP binding
GO:0019904	protein domain specific binding
GO:0031683	G-protein beta/gamma-subunit complex binding
GO:0031821	G protein-coupled serotonin receptor binding
GO:0032794	GTPase activating protein binding
GO:0046872	metal ion binding

	Biological Process
GO:0006906	vesicle fusion
GO:0007165	signal transduction
GO:0007186	G protein-coupled receptor signaling pathway
GO:0007188	adenylate cyclase-modulating G protein-coupled receptor signaling pathway
GO:0007193	adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway
GO:0007212	G protein-coupled dopamine receptor signaling pathway
GO:0008016	regulation of heart contraction
GO:0016239	positive regulation of macroautophagy
GO:0032930	positive regulation of superoxide anion generation
GO:0046039	GTP metabolic process
GO:0051048	negative regulation of secretion
GO:0051301	cell division
GO:1904707	positive regulation of vascular associated smooth muscle cell proliferation
GO:2001234	negative regulation of apoptotic signaling pathway

	Cellular Component
GO:0000139	Golgi membrane
GO:0005737	cytoplasm
GO:0005789	endoplasmic reticulum membrane
GO:0005794	Golgi apparatus
GO:0005813	centrosome
GO:0005834	heterotrimeric G-protein complex
GO:0005856	cytoskeleton
GO:0005886	plasma membrane
GO:0030496	midbody
GO:0042588	zymogen granule

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6mhf, PDBe:6mhf, PDBj:6mhf
PDBsum	6mhf
PubMed	31363053
UniProt	P08753\|GNAI3_RAT Guanine nucleotide-binding protein G(i) subunit alpha-3 (Gene Name=Gnai3)

[Back to BioLiP]