Structure of PDB 6max Chain A |
>6maxA (length=111) Species: 243274 (Thermotoga maritima MSB8) [Search protein sequence] |
AHHHERLRLRRDFLLIFKEGKSLQNEYFVVLFRKNGLDYSRLGIVVKRKF GKATRRNKLKRWVREIFRRNKGVIPKGFDIVVIPRKKLSEEFERVDFWTV REKLLNLLKRI |
|
PDB | 6max A screening platform to monitor RNA processing and protein-RNA interactions in ribonuclease P uncovers a small molecule inhibitor. |
Chain | A |
Resolution | 1.42 Å |
3D structure |
|
|
Enzyme Commision number |
3.1.26.5: ribonuclease P. |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
9TF |
A |
Q28 V33 R89 |
Q24 V29 R85 |
MOAD: Ki=1.9uM |
|
|
|