Structure of PDB 6mak Chain A

Receptor sequence

>6makA (length=272) Species: 9606 (Homo sapiens)

MIKTIAFGRYELDTWYHSPYPEEYARLGRLYMCEFCLKYMKSQTILRRHM
AKCVWKHPPGDEIYRKGSISVFEVDGKKNKIYCQNLCLLAKLFLDHKTLY
YDVEPFLFYVMTEADNTGCHLIGYFSKEKNSFLNYNVSCILTMPQYMRQG
YGKMLIDFSYLLSKVEEKVGSPERPLSDLGLISYRSYWKEVLLRYLHNFQ
GKEISIKEISQETAVNPVDIVSTLQALQMLKYWKGKHLVLKRQDLIDEWI
AKEAKRSNSNKTMDPSCLKWTP

3D structure

• PDB: 6mak HBO1 is required for the maintenance of leukaemia stem cells.
• Chain: A
• Resolution: 2.13 Å

Enzymatic activity

• Enzyme Commision number: 2.3.1.48: histone acetyltransferase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	A	F534 K537 E538 I539 S540 I541 K542 Q560 L565 Y567 H572 L573 V574 L575 K576	F199 K202 E203 I204 S205 I206 K207 Q225 L230 Y232 H237 L238 V239 L240 K241
BS02	ZN	A	C368 C371 H384 C388	C33 C36 H49 C53
BS03	ACO	A	F428 L429 C474 I475 L476 T477 M482 R483 G485 G487 K488 L511 S512 L514 I517 S518 S521	F93 L94 C139 I140 L141 T142 M147 R148 G150 G152 K153 L176 S177 L179 I182 S183 S186

Gene Ontology

Molecular Function

• GO:0004402 histone acetyltransferase activity

Biological Process

• GO:0006355 regulation of DNA-templated transcription

External links

• PDB: RCSB:6mak, PDBe:6mak, PDBj:6mak
• PDBsum: 6mak
• PubMed: 31827282
• UniProt: O95251|KAT7_HUMAN Histone acetyltransferase KAT7 (Gene Name=KAT7)