Structure of PDB 6m7o Chain A

Receptor sequence

>6m7oA (length=423) Species: 9606 (Homo sapiens)

TGQDRVVALVDMDCFFVQVEQRQNPHLRNKPCAVVQYKSWKGGGIIAVSY
EARAFGVTRSMWADDAKKLCPDLLLAQVRESRGKANLTKYREASVEVMEI
MSRFAVIERASIDEAYVDLTSAVQERLQKLQGQPISADLLPSTYIEGLPQ
GTVQKEGMRKQGLFQWLDSLQIDNLTSPDLQLTVGAVIVEEMRAAIERET
GFQCSAGISHNKVLAKLACGLNKPNRQTLVSHGSVPQLFSQMPIRKIRSL
GGKLGASVIEILGIEYMGELTQFTESQLQSHFGEKNGSWLYAMCRGIEHD
PVKPRQLPKTIGCSKNFPGKTALATREQVQWWLLQLAQELEERLTKDRND
NDRVATQLVVSIRVQGDKRLSSLRRCCALTRYDAHKMSHDAFTVIKNCNT
SGIQTEWSPPLTMLFLCATKFSA

3D structure

• PDB: 6m7o Bypassing a 8,5'-cyclo-2'-deoxyadenosine lesion by human DNA polymerase eta at atomic resolution.
• Chain: A
• Resolution: 3.0 Å

Enzymatic activity

• Enzyme Commision number: 2.7.7.7: DNA-directed DNA polymerase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	A	Q38 Y39 W42 I48 K86 K311 R313 P316 K317 T318 G320 S322 K323 N324 P326 R351	Q36 Y37 W40 I46 K84 K303 R305 P308 K309 T310 G312 S314 K315 N316 P318 R343
BS02	dna	A	S113 E116 K224 S257 G259 K261 L262 R377 R382 C384	S111 E114 K216 S249 G251 K253 L254 R369 R374 C376
BS03	MN	A	D13 M14 D115	D11 M12 D113
BS04	MN	A	D13 D115 E116	D11 D113 E114
BS05	1FZ	A	D13 M14 C16 F18 Y52 R55 R61 D115 K231	D11 M12 C14 F16 Y50 R53 R59 D113 K223

Gene Ontology

Molecular Function

• GO:0003684 damaged DNA binding

Biological Process

• GO:0006281 DNA repair

External links

• PDB: RCSB:6m7o, PDBe:6m7o, PDBj:6m7o
• PDBsum: 6m7o
• PubMed: 30275308
• UniProt: Q9Y253|POLH_HUMAN DNA polymerase eta (Gene Name=POLH)