Structure of PDB 6m79 Chain A

Receptor sequence
>6m79A (length=460) Species: 3702 (Arabidopsis thaliana) [Search protein sequence]
KKTIVWFRRDLRIEDNPALAAAAHEGSVFPVFIWCPEEEGQFYPGRASRW
WMKQSLAHLSQSLKALGSDLTLIQTHNTISAILDCIRVTGPTKVVFNHLY
DPVSLVRDHTVKEKLVERGISVQSYNGDLLYEPWEIYCEKGKPFTSFNSY
WKKCLDMSIESVMLPPPWRLMPIIWACSIEELGLENEAEKPSNALLTRAW
SPGWSNADKLLNEFIEKQLIDYAKNSKKVVGNSTSLLSPYLHFGEISVRH
VFQCARMKQIIWARDKNSEGEESADLFLRGIGLREYSRYICFNFPPWDAD
VDKFKAWRQGRTGYPLVDAGMRELWATGWMHNRIRVIVSSFGVKFLLLPW
KWGMKYFWDTLLDADLECDILGWQYISGSIPDGHELDRLDNPALQGAKYD
PEGEYIRQWLPELARLPTEWIHHPWDAPLTVLKASGVELGTNYAKPIVDI
DTARELLAKA
3D structure
PDB6m79 Structural insights into the photoactivation of Arabidopsis CRY2.
ChainA
Resolution3.1 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) G290 L293 W321 N356 W374 W397
Catalytic site (residue number reindexed from 1) G280 L283 W297 N332 W350 W373
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 AMP A N356 Y399 D406 N332 Y375 D382
BS02 FAD A Y232 T244 S245 L246 G290 N356 R359 C392 Y222 T234 S235 L236 G280 N332 R335 C368
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0005524 ATP binding
GO:0009881 photoreceptor activity
GO:0009882 blue light photoreceptor activity
GO:0016301 kinase activity
GO:0042802 identical protein binding
GO:0042803 protein homodimerization activity
GO:0046872 metal ion binding
GO:0071949 FAD binding
GO:0097159 organic cyclic compound binding
Biological Process
GO:0006139 nucleobase-containing compound metabolic process
GO:0006325 chromatin organization
GO:0006338 chromatin remodeling
GO:0006950 response to stress
GO:0006952 defense response
GO:0007623 circadian rhythm
GO:0009414 response to water deprivation
GO:0009416 response to light stimulus
GO:0009637 response to blue light
GO:0009638 phototropism
GO:0009646 response to absence of light
GO:0009785 blue light signaling pathway
GO:0009909 regulation of flower development
GO:0009911 positive regulation of flower development
GO:0010075 regulation of meristem growth
GO:0010118 stomatal movement
GO:0010244 response to low fluence blue light stimulus by blue low-fluence system
GO:0010617 circadian regulation of calcium ion oscillation
GO:0042752 regulation of circadian rhythm
GO:0046777 protein autophosphorylation
GO:0048574 long-day photoperiodism, flowering
GO:0051607 defense response to virus
GO:0072387 flavin adenine dinucleotide metabolic process
GO:1901371 regulation of leaf morphogenesis
GO:1902347 response to strigolactone
GO:2000028 regulation of photoperiodism, flowering
GO:2000379 positive regulation of reactive oxygen species metabolic process
Cellular Component
GO:0000325 plant-type vacuole
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0016604 nuclear body
GO:0016605 PML body

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6m79, PDBe:6m79, PDBj:6m79
PDBsum6m79
PubMed33199893
UniProtQ96524|CRY2_ARATH Cryptochrome-2 (Gene Name=CRY2)

[Back to BioLiP]