Structure of PDB 6m5y Chain A

Receptor sequence
>6m5yA (length=270) Species: 9606 (Homo sapiens) [Search protein sequence]
SGLVASNLNLKPGESLRVRGEVAPDAKSFVLNLGKDSNNLCLHFNPRFNA
HGDANTIVSNSKDGGAWGTEQREAVFPFQPGSVAEVSITFDQANLTVKLP
DGYEFKFPNRLNLEAINYMAADGDFKIKSVAFDGSSASGLVASNLNLKPG
ESLRVRGEVAPDAKSFVLNLGKDSNNLCLHFNPRFNAHGDANTIVSNSKD
GGAWGTEQREAVFPFQPGSVAEVSITFDQANLTVKLPDGYEFKFPNRLNL
EAINYMAADGDFKIKSVAFD
3D structure
PDB6m5y Crystal structure and conformational stability of a galectin-1 tandem-repeat mutant with a short linker.
ChainA
Resolution1.38 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 BGC A R49 E72 R74 R47 E70 R72
BS02 GAL A H45 R49 H53 N62 W69 E72 H43 R47 H51 N60 W67 E70
BS03 GLC A R186 E209 R184 E207
BS04 GAL A H182 R186 W206 E209 H180 R184 W204 E207
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0005515 protein binding
GO:0030246 carbohydrate binding
GO:0030395 lactose binding
GO:0043236 laminin binding
GO:0048018 receptor ligand activity
Biological Process
GO:0002317 plasma cell differentiation
GO:0006915 apoptotic process
GO:0007165 signal transduction
GO:0031295 T cell costimulation
GO:0042981 regulation of apoptotic process
GO:0043065 positive regulation of apoptotic process
GO:0043123 positive regulation of canonical NF-kappaB signal transduction
GO:0045445 myoblast differentiation
GO:0046598 positive regulation of viral entry into host cell
GO:0050729 positive regulation of inflammatory response
GO:0098609 cell-cell adhesion
GO:2000329 negative regulation of T-helper 17 cell lineage commitment
GO:2001200 positive regulation of dendritic cell differentiation
Cellular Component
GO:0005576 extracellular region
GO:0005615 extracellular space
GO:0005737 cytoplasm
GO:0005788 endoplasmic reticulum lumen
GO:0005829 cytosol
GO:0005886 plasma membrane
GO:0062023 collagen-containing extracellular matrix
GO:0070062 extracellular exosome
GO:1990724 galectin complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6m5y, PDBe:6m5y, PDBj:6m5y
PDBsum6m5y
PubMed34735570
UniProtP09382|LEG1_HUMAN Galectin-1 (Gene Name=LGALS1)

[Back to BioLiP]