Structure of PDB 6m4h Chain A

Receptor sequence
>6m4hA (length=74) Species: 9606 (Homo sapiens) [Search protein sequence]
LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNL
CAIHAKRVTIMPKDIQLARRIRGE
3D structure
PDB6m4h Structural basis of nucleosome dynamics modulation by histone variants H2A.B and H2A.Z.2.2.
ChainA
Resolution3.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 dna A R63 K64 L65 R69 R83 R4 K5 L6 R10 R24
BS02 dna A R63 R72 R83 F84 S86 R116 V117 T118 M120 R4 R13 R24 F25 S27 R57 V58 T59 M61
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0045296 cadherin binding
GO:0046982 protein heterodimerization activity
Biological Process
GO:0006325 chromatin organization
GO:0006334 nucleosome assembly
GO:0010467 gene expression
GO:0032200 telomere organization
GO:0040029 epigenetic regulation of gene expression
Cellular Component
GO:0000786 nucleosome
GO:0005576 extracellular region
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005694 chromosome
GO:0016020 membrane
GO:0032991 protein-containing complex
GO:0070062 extracellular exosome

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:6m4h, PDBe:6m4h, PDBj:6m4h
PDBsum6m4h
PubMed33073403
UniProtP68431|H31_HUMAN Histone H3.1 (Gene Name=H3C1)

[Back to BioLiP]