Structure of PDB 6lsb Chain A

Receptor sequence

>6lsbA (length=121) Species: 9606 (Homo sapiens)

SLPHEKDKPVAEPIPICSFCLGTKEQNREKKPEELISCADCGNSGHPSCL
KFSPELTVRVKALRWQCIECKTCSSCRDQGKNADNMLFCDSCDRGFHMEC
CDPPLTRMPKGMWICQICRPR

3D structure

• PDB: 6lsb Histone benzoylation serves as an epigenetic mark for DPF and YEATS family proteins.
• Chain: A
• Resolution: 2.0 Å

Enzymatic activity

• Enzyme Commision number: 2.3.1.48: histone acetyltransferase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	A	I208 S210 F211 L213 N235 S236 L242 K243 W257 C259 I260 E261 Q271 A275 D276 M278 L279 F280 C281 D282 D285 M300 P301 G303	I16 S18 F19 L21 N43 S44 L50 K51 W65 C67 I68 E69 Q79 A83 D84 M86 L87 F88 C89 D90 D93 M108 P109 G111
BS02	ZN	A	C209 C212 H238 C241	C17 C20 H46 C49
BS03	ZN	A	C281 C284 C307 C310	C89 C92 C115 C118
BS04	ZN	A	C230 C233 C259 C262	C38 C41 C67 C70
BS05	ZN	A	C265 C268 H289 C292	C73 C76 H97 C100

External links

• PDB: RCSB:6lsb, PDBe:6lsb, PDBj:6lsb
• PDBsum: 6lsb
• PubMed: 33290558
• UniProt: Q92794|KAT6A_HUMAN Histone acetyltransferase KAT6A (Gene Name=KAT6A)