Structure of PDB 6ls4 Chain A

Receptor sequence

>6ls4A (length=429) Species: 9823 (Sus scrofa)

RECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNT
FFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAAN
NYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFTS
LLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCA
FMVDNEAIYDICRRNLDIERPTYTNLNRLISQIVSSITASLRFDLNVDLT
EFQTNLVPYPRIHFPLATYAPVISAEHEQLSVAEITNACFEPANQMVKCD
PRHGKYMACCLLYRGDVVPKDVNAAIATIKTRSIQFVDWCPTGFKVGINY
QPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHW
YVGEGMEEGEFSEAREDMAALEKDYEEVG

3D structure

• PDB: 6ls4 A novel orally active microtubule destabilizing agent S-40 targets the colchicine-binding site and shows potent antitumor activity.
• Chain: A
• Resolution: 2.4 Å

Enzymatic activity

• Enzyme Commision number: 3.6.5.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	GTP	A	G10 A12 Q15 A99 N101 S140 G143 G144 T145 G146 S178 E183 N206 Y224 N228	G9 A11 Q14 A98 N100 S139 G142 G143 T144 G145 S177 E182 N205 Y223 N227
BS02	MG	A	D39 T41 G44 E55	D38 T40 G43 E54
BS03	S40	A	T179 V181	T178 V180

Gene Ontology

Molecular Function

• GO:0003924 GTPase activity
• GO:0005200 structural constituent of cytoskeleton
• GO:0005525 GTP binding
• GO:0016787 hydrolase activity
• GO:0046872 metal ion binding

Biological Process

• GO:0000226 microtubule cytoskeleton organization
• GO:0000278 mitotic cell cycle
• GO:0007017 microtubule-based process

Cellular Component

• GO:0005737 cytoplasm
• GO:0005856 cytoskeleton
• GO:0005874 microtubule
• GO:0015630 microtubule cytoskeleton

External links

• PDB: RCSB:6ls4, PDBe:6ls4, PDBj:6ls4
• PDBsum: 6ls4
• PubMed: 32931884
• UniProt: Q2XVP4|TBA1B_PIG Tubulin alpha-1B chain (Gene Name=TUBA1B)