Structure of PDB 6lqc Chain A

Receptor sequence

>6lqcA (length=450) Species: 2026738 (Erythrobacteraceae bacterium)

QTDADVIVIGAGPSGSYAAKLLHDQGVRVKLVEAKDRVGGRTWSTKSDAP
GGPIDFGGQWIGETHVLLPELGAELGLETVSSVKPGNDLFVFNGDVEVGE
EDQVPSGASWAGELSRSFELLDEVGTRLGWAAPWASEHVGELDSMTVAQW
LEQNVQSSEVRLIHEVMVNILNGASTTEVSMAYWAYFVHQGEGIESLIGT
RSGAQVAWFIGGMGQVTELIADKLGDDVHLNWPVTRIEQDPTGVTVFSGE
RRLRASFAILAAPPSAGSRMIFDPPLPPKRAQLQARAPMGRLAKIQVRYD
EPFWQERGLSGAAFECGDLAFWLFDGSKPTDSLATIVGFIGGKHLDAWHA
LSPNEREKRFIEILVNNFGDKARDVRYVHETDWTVQPWTGGAPVTFMPTG
LLSSAGSALREPVDRLHFAGTEAAPMWSGYIEGALRAGKIAAGDVLARLA

3D structure

• PDB: 6lqc Asymmetric Synthesis of a Key Dextromethorphan Intermediate and Its Analogues Enabled by a New Cyclohexylamine Oxidase: Enzyme Discovery, Reaction Development, and Mechanistic Insight.
• Chain: A
• Resolution: 1.88 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	FAD	A	G13 G15 P16 S17 E36 A37 K38 G43 R44 G61 W63 P236 V237 A269 W386 P396 G423 G432 Y433 I434 A437	G10 G12 P13 S14 E33 A34 K35 G40 R41 G58 W60 P233 V234 A266 W383 P393 G420 G429 Y430 I431 A434

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Tue Nov 26 10:26:50 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '6lqc', asym_id = 'A', title = 'Asymmetric Synthesis of a Key Dextromethorphan I..., Reaction Development, and Mechanistic Insight. '

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='6lqc', asym_id='A', title='Asymmetric Synthesis of a Key Dextromethorphan I..., Reaction Development, and Mechanistic Insight. ')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0016491', uniprot = '', pdbid = '6lqc', asym_id = 'A'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0016491', uniprot='', pdbid='6lqc', asym_id='A')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>