Structure of PDB 6los Chain A

Receptor sequence

>6losA (length=369) Species: 10090 (Mus musculus) [Search protein sequence]

EPVEEEDPFFKVPVNKLAAAVSNFGYDLYRLRSSASPTGNVLLSPLSVAT
ALSALSLGAEHRTESVIHRALYYDLITNPDIHSTYKELLASVTAPEKNLK
SASRIVFERKLRVKSSFVAPLEKSYGTRPRILTGNPRVDLQEINNWVQAQ
MKGKIARSTREMPSALSILLLGVAYFKGQWVTKFDSRKTTLQDFHLDEDR
TVRVPMMSDPKAILRYGLDSDLNCKIAQLPLTGSMSIIFFLPLTVTQNLT
MIEESLTSEFIHDIDRELKTIQAVLTVPKLKLSFEGELTKSLQDMKLQSL
FESPDFSKITGKPVKLTQVEHRAAFEWNEEGAGSSFPLDYHLNQPFLFVL
RDTDTGALLFIGRILDPSS

3D structure

PDB

6los Spatiotemporal regulation of PEDF signaling by type I collagen remodeling.

Chain

Resolution

2.476 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	A	D255 D299 K305	D219 D263 K269
BS02	peptide	A	G253 L254 D257 S291 F296 E303 L304 F383	G217 L218 D221 S255 F260 E267 L268 F336

Gene Ontology

	Molecular Function
GO:0004867	serine-type endopeptidase inhibitor activity

	Biological Process
GO:0001822	kidney development
GO:0007614	short-term memory
GO:0010447	response to acidic pH
GO:0010596	negative regulation of endothelial cell migration
GO:0010629	negative regulation of gene expression
GO:0010976	positive regulation of neuron projection development
GO:0014070	response to organic cyclic compound
GO:0016525	negative regulation of angiogenesis
GO:0042698	ovulation cycle
GO:0046685	response to arsenic-containing substance
GO:0050769	positive regulation of neurogenesis
GO:0060041	retina development in camera-type eye
GO:0060767	epithelial cell proliferation involved in prostate gland development
GO:0060770	negative regulation of epithelial cell proliferation involved in prostate gland development
GO:0071279	cellular response to cobalt ion
GO:0071300	cellular response to retinoic acid
GO:0071333	cellular response to glucose stimulus
GO:0071549	cellular response to dexamethasone stimulus
GO:1901652	response to peptide

	Cellular Component
GO:0005576	extracellular region
GO:0005604	basement membrane
GO:0005615	extracellular space
GO:0030424	axon
GO:0042470	melanosome
GO:0043025	neuronal cell body
GO:0043203	axon hillock
GO:0048471	perinuclear region of cytoplasm

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6los, PDBe:6los, PDBj:6los
PDBsum	6los
PubMed	32385162
UniProt	P97298\|PEDF_MOUSE Pigment epithelium-derived factor (Gene Name=Serpinf1)

[Back to BioLiP]