Structure of PDB 6loe Chain A

Receptor sequence

>6loeA (length=218) Species: 383372 (Roseiflexus castenholzii DSM 13941) [Search protein sequence]

QVFDRRANTLARVSIFAGIPLVLAILGGVWWLFGWSDWHRDVGVEIPQPG
GGFNHQLHVALGMDCRYCHTAVEVSAHANIPPTETCMGCHSQIISRSEKV
AFVWQSWETGTSIQWNKVHDLPKFVYFNHSIHVAKGVGCSTCHGRIDQMR
VVYKTQPLFMSWCLDCHRNPEKYVRPREEVFNMAWTPPPNQLEVGRRLVQ
EYEIRSSWELTNCAICHR

3D structure

PDB

6loe Cryo-EM structures of the air-oxidized and dithionite-reduced photosynthetic alternative complex III from Roseiflexus castenholzii .

Chain

Resolution

3.5 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	HEC	A	R48 P130 F132 V133 L166 F167 M168 C171 L172 H175 C221 C224 H225	R40 P122 F124 V125 L158 F159 M160 C163 L164 H167 C213 C216 H217
BS02	HEC	A	F135 I139 H140 K143 V145 W170 C171 C174 H175 I212 R213 L218 I223 C224	F127 I131 H132 K135 V137 W162 C163 C166 H167 I204 R205 L210 I215 C216
BS03	HEC	A	H77 H85 A86 I88 K125 H127 L129 F135 H137 H140 V141 V145 C147 C150 H151 F189	H69 H77 A78 I80 K117 H119 L121 F127 H129 H132 V133 V137 C139 C142 H143 F181
BS04	HEC	A	Q56 F61 H63 M71 C73 C76 H77 I88 P89 W123 K125 V126 H127 H151 I154 V160 M191	Q48 F53 H55 M63 C65 C68 H69 I80 P81 W115 K117 V118 H119 H143 I146 V152 M183
BS05	HEC	A	G59 F61 N62 L65 H66 L69 M71 C94 C97 H98 I101 I102 W123	G51 F53 N54 L57 H58 L61 M63 C86 C89 H90 I93 I94 W115
BS06	EL6	A	V37 F41	V29 F33

Gene Ontology

	Cellular Component
GO:0016020	membrane

View graph for
Cellular Component

External links

PDB	RCSB:6loe, PDBe:6loe, PDBj:6loe
PDBsum	6loe
PubMed	32832681
UniProt	A7NJ87

[Back to BioLiP]