Structure of PDB 6lhn Chain A

Receptor sequence

>6lhnA (length=76) Species: 3702 (Arabidopsis thaliana)

RLGSGGGVCGSVWGQNDIAYRCRTCENDPTCAICVPCFQNGDHNSHDYSI
IYTGGGCCDCGDETAWKPDGFCSNHK

3D structure

• PDB: 6lhn Use of the LC3B-fusion technique for biochemical and structural studies of proteins involved in the N-degron pathway.
• Chain: A
• Resolution: 2.5 Å

Enzymatic activity

• Enzyme Commision number: 2.3.2.27: RING-type E3 ubiquitin transferase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ZN	A	C149 C172 C184 H187	C37 C60 C72 H75
BS02	ZN	A	C121 C146 C149 C170	C9 C34 C37 C58
BS03	ZN	A	C134 C137 H155 H158	C22 C25 H43 H46

Gene Ontology

Molecular Function

• GO:0008270 zinc ion binding
• GO:0061630 ubiquitin protein ligase activity

Biological Process

• GO:0071596 ubiquitin-dependent protein catabolic process via the N-end rule pathway

External links

• PDB: RCSB:6lhn, PDBe:6lhn, PDBj:6lhn
• PDBsum: 6lhn
• PubMed: 31919097
• UniProt: F4KCC2|PRT6_ARATH E3 ubiquitin-protein ligase PRT6 (Gene Name=PRT6)