Structure of PDB 6lc1 Chain A

Receptor sequence
>6lc1A (length=86) Species: 9606 (Homo sapiens) [Search protein sequence]
RCAVCGDNASCQHYGVRTCEGCKGFFKRTVQKNAKYICLANKDCPVDKRR
RNRCQFCRFQKCLAVGMVKEVVRTDSLKGRRGRLPS
3D structure
PDB6lc1 Structural basis of NR4A1 bound to the human pituitary proopiomelanocortin gene promoter.
ChainA
Resolution3.12 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna A R293 R316 N317 R346 G347 R348 R28 R51 N52 R81 G82 R83 PDBbind-CN: Kd=135.33nM
BS02 dna A Q277 H278 Y279 K288 K292 Q296 V336 R338 R345 R346 G347 R348 Q12 H13 Y14 K23 K27 Q31 V71 R73 R80 R81 G82 R83 PDBbind-CN: Kd=135.33nM
BS03 ZN A C309 C319 C44 C54
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0008270 zinc ion binding
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:6lc1, PDBe:6lc1, PDBj:6lc1
PDBsum6lc1
PubMed31822342
UniProtP22736|NR4A1_HUMAN Nuclear receptor subfamily 4immunitygroup A member 1 (Gene Name=NR4A1)

[Back to BioLiP]