Structure of PDB 6krt Chain A

Receptor sequence

>6krtA (length=433) Species: 159298 (Deschampsia antarctica)

TEKHFKYVVLGGGVAGGYAAREFAKQGVQPGELAIISREAVAPYERPALS
KAYLFPQNPARLPGFHVCVGSGGERLLPEWYSEKGIELILNTEIVKADLA
SKTLTSAAGATFTYEILLIATGSSVIKLSDFGTQGADSNNILYLREVDDA
DKLYAAIQAKKGGKAVVVGGGYIGLELSAVLKMNNLDVTMVFPEPWCMPR
LFTAEIAAFYESYYTNKGVKIVKGTVAVGFDADANGDVTAVKLKDGSVLE
ADIVVVGVGGRPLTTLFKGQVAEEKGGIKTDASFETSVPGVYAVGDVATF
PMKIYNDVRRVEHVDHSRKSAEQAVKAIKGKESGEAVPEYDYLPYFYSRS
FDLSWQFYGDNVGEAVLFGDSDPASAKPKFGSYWIKDGKVVGAFLEGGSG
DENGLIAKVARAQPPVSSIEELKQDGLLFASKI

3D structure

• PDB: 6krt monodehydroascorbate reductase, MDHAR, from Antarctic hairgrass Deschampsia antarctica
• Chain: A
• Resolution: 2.2 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	FAD	A	G13 G14 G15 V16 A17 R40 E41 R48 P49 I96 A122 T123 G124 R147 E148 Y174 I175 G297 D298 V316 S319 F348 Y349	G11 G12 G13 V14 A15 R38 E39 R46 P47 I94 A120 T121 G122 R145 E146 Y172 I173 G295 D296 V314 S317 F346 Y347

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Wed Dec 4 21:15:14 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '6krt', asym_id = 'A', title = 'monodehydroascorbate reductase, MDHAR, from Antarctic hairgrass Deschampsia antarctica'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='6krt', asym_id='A', title='monodehydroascorbate reductase, MDHAR, from Antarctic hairgrass Deschampsia antarctica')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0016491', uniprot = '', pdbid = '6krt', asym_id = 'A'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0016491', uniprot='', pdbid='6krt', asym_id='A')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>