Structure of PDB 6koe Chain A

Receptor sequence

>6koeA (length=607) Species: 1423 (Bacillus subtilis)

PLILGAQVSIALSTIAIIFVLTYFKKWKWLWSEWITTVDHKKLGIMYIIS
AVIMLFRGGVDGLMMRAQLALPNNSFLDSNHYNEIFTTHGTIMIIFMAMP
FLIGLINVVVPLQIGARDVAFPYLNNLSFWTFFVGAMLFNISFVIGGSPN
AGWTSYMPLASNDMSPGPGENYYLLGLQIAGIGTLMTGINFMVTILKMRT
KGMTLMRMPMFTWTTLITMVIIVFAFPVLTVALALLSFDRLFGAHFFTLE
AGGMPMLWANLFWIWGHPEVYIVILPAFGIFSEIISSFARKQLFGYKAMV
GSIIAISVLSFLVWTHHFFTMGNSASVNSFFSITTMAISIPTGVKIFNWL
FTMYKGRISFTTPMLWALAFIPNFVIGGVTGVMLAMAAADYQYHNTYFLV
SHFHYVLIAGTVFACFAGFIFWYPKMFGHKLNERIGKWFFWIFMIGFNIC
FFPQYFLGLQGMPRRIYTYGPNDGWTTLNFISTVGAFMMGVGFLILCYNI
YYSGVGRTLDWATSSAIPPHYNFAVLPEVKSQDAFLHMKEEKTELYPESK
FKKIHMPSNSGRPFFMSVAFGLAGFGLVFEWYWMGVVGLIGVLLCMVLRS
FEYDNGY

3D structure

• PDB: 6koe Structure of the cytochromeaa3-600 heme-copper menaquinol oxidase bound to inhibitor HQNO shows TM0 is part of the quinol binding site.
• Chain: A
• Resolution: 3.75 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): H102 D131 W166 G196 T197 H280 E282 Y284 S295 H329 H330 T355 K358 R477
• Catalytic site (residue number reindexed from 1): H89 D118 W153 G183 T184 H267 E269 Y271 S282 H316 H317 T342 K345 R464
• Enzyme Commision number: 1.10.3.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEA	A	G72 L76 M78 R79 F99 H102 M106 I107 G165 W166 F416 H417 L420 I421 R477 R478 A499 M502 G503 F506	G59 L63 M65 R66 F86 H89 M93 I94 G152 W153 F403 H404 L407 I408 R464 R465 A486 M489 G490 F493
BS02	HEA	A	W166 W276 V283 I287 H329 H330 T348 S352 T355 G391 G394 L397 A398 H407 L412 H415 F416 V419	W153 W263 V270 I274 H316 H317 T335 S339 T342 G378 G381 L384 A385 H394 L399 H402 F403 V406
BS03	CU	A	H280 H329 H330	H267 H316 H317
BS04	HQO	A	R70 D74 H94 E97 I98 T101 F156 S161	R57 D61 H81 E84 I85 T88 F143 S148

Gene Ontology

Molecular Function

• GO:0004129 cytochrome-c oxidase activity
• GO:0005507 copper ion binding
• GO:0016491 oxidoreductase activity
• GO:0016682 oxidoreductase activity, acting on diphenols and related substances as donors, oxygen as acceptor
• GO:0020037 heme binding
• GO:0046872 metal ion binding

Biological Process

• GO:0006119 oxidative phosphorylation
• GO:0009060 aerobic respiration
• GO:0015990 electron transport coupled proton transport
• GO:0022904 respiratory electron transport chain
• GO:0042773 ATP synthesis coupled electron transport
• GO:1902600 proton transmembrane transport

Cellular Component

• GO:0005886 plasma membrane
• GO:0016020 membrane

External links

• PDB: RCSB:6koe, PDBe:6koe, PDBj:6koe
• PDBsum: 6koe
• PubMed: 31888984
• UniProt: P34956|QOX1_BACSU Quinol oxidase subunit 1 (Gene Name=qoxB)