Structure of PDB 6klu Chain A

Receptor sequence

>6kluA (length=150) Species: 10090 (Mus musculus)

DDIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGCISTKELGKVMRMLGQN
PTPEELQEMIDEVDEDGSGTVDFDEFLVMMVRCMSEEELSDLFRMFDKNA
DGYIDLDELKMMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMK

3D structure

• PDB: 6klu Cryo-EM structures of cardiac thin filaments reveal the 3D architecture of troponin.
• Chain: A
• Resolution: 12.0 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	CA	A	D65 D67 S69 T71 E76	D64 D66 S68 T70 E75
BS02	CA	A	D141 N143 D145 R147 E152	D133 N135 D137 R139 E144
BS03	CA	A	D105 N107 D109 Y111 E116	D97 N99 D101 Y103 E108

Gene Ontology

Molecular Function

• GO:0005509 calcium ion binding
• GO:0031013 troponin I binding
• GO:0031014 troponin T binding
• GO:0042803 protein homodimerization activity
• GO:0046872 metal ion binding
• GO:0048306 calcium-dependent protein binding
• GO:0051015 actin filament binding

Biological Process

• GO:0002086 diaphragm contraction
• GO:0006937 regulation of muscle contraction
• GO:0010038 response to metal ion
• GO:0014883 transition between fast and slow fiber
• GO:0032972 regulation of muscle filament sliding speed
• GO:0043462 regulation of ATP-dependent activity
• GO:0055010 ventricular cardiac muscle tissue morphogenesis
• GO:0060048 cardiac muscle contraction

Cellular Component

• GO:0005861 troponin complex
• GO:0043292 contractile muscle fiber
• GO:1990584 cardiac Troponin complex

External links

• PDB: RCSB:6klu, PDBe:6klu, PDBj:6klu
• PDBsum: 6klu
• PubMed: 31954841
• UniProt: P19123|TNNC1_MOUSE Troponin C, slow skeletal and cardiac muscles (Gene Name=Tnnc1)