Structure of PDB 6klt Chain A

Receptor sequence
>6kltA (length=138) Species: 10090 (Mus musculus) [Search protein sequence]
TEEQKNEFKAAFDIFVLGADGCISTKELGKVMRMLGQNPTPEELQEMIDE
VDEDGSGTVDFDEFLVMMVRCMSEEELSDLFRMFDKNADGYIDLDELKMM
LQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMK
3D structure
PDB6klt Cryo-EM structures of cardiac thin filaments reveal the 3D architecture of troponin.
ChainA
Resolution12.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CA A D142 N144 D146 R148 E153 D121 N123 D125 R127 E132
BS02 CA A D106 N108 D110 Y112 E117 D85 N87 D89 Y91 E96
Gene Ontology
Molecular Function
GO:0005509 calcium ion binding
GO:0031013 troponin I binding
GO:0031014 troponin T binding
GO:0042803 protein homodimerization activity
GO:0046872 metal ion binding
GO:0048306 calcium-dependent protein binding
GO:0051015 actin filament binding
Biological Process
GO:0002086 diaphragm contraction
GO:0006937 regulation of muscle contraction
GO:0010038 response to metal ion
GO:0014883 transition between fast and slow fiber
GO:0032972 regulation of muscle filament sliding speed
GO:0043462 regulation of ATP-dependent activity
GO:0055010 ventricular cardiac muscle tissue morphogenesis
GO:0060048 cardiac muscle contraction
Cellular Component
GO:0005861 troponin complex
GO:0043292 contractile muscle fiber
GO:1990584 cardiac Troponin complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6klt, PDBe:6klt, PDBj:6klt
PDBsum6klt
PubMed31954841
UniProtP19123|TNNC1_MOUSE Troponin C, slow skeletal and cardiac muscles (Gene Name=Tnnc1)

[Back to BioLiP]