Structure of PDB 6khd Chain A

Receptor sequence

>6khdA (length=322) Species: 9606 (Homo sapiens)

LICQSGDVLSARYEIVDTLGEGAFGKVVECIDHKAGGRHVAVKIVKNVDR
YCEAARSEIQVLEHLNTTDPNSTFRCVQMLEWFEHHGHICIVFELLGLST
YDFIKENGFLPFRLDHIRKMAYQICKSVNFLHSNKLTHTDLKPENILFVQ
SDYTEERTLINPDIKVVDFGSATYDDEHHSTLVRHYRAPEVILALGWSQP
CDVWSIGCILIEYYLGFTVFPTHDSKEHLAMMERILGPLPKHMIQKTRKR
KYFHHDRLDWDEHSSAGRYVSRACKPLKEFMLSQDVEHERLFDLIQKMLE
YDPAKRITLREALKHPFFDLLK

3D structure

• PDB: 6khd Structural Basis for the Selective Inhibition of Cdc2-Like Kinases by CX-4945.
• Chain: A
• Resolution: 2.7 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): D288 K290 N293 D325
• Catalytic site (residue number reindexed from 1): D140 K142 N145 D168
• Enzyme Commision number: 2.7.12.1: dual-specificity kinase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	3NG	A	L167 G168 E169 F172 V175 A189 K191 F241 L244 L295 V324	L19 G20 E21 F24 V27 A41 K43 F93 L96 L147 V167

Gene Ontology

Molecular Function

• GO:0004672 protein kinase activity
• GO:0004674 protein serine/threonine kinase activity
• GO:0004712 protein serine/threonine/tyrosine kinase activity
• GO:0004713 protein tyrosine kinase activity
• GO:0004715 non-membrane spanning protein tyrosine kinase activity
• GO:0005515 protein binding
• GO:0005524 ATP binding
• GO:0106310 protein serine kinase activity

Biological Process

• GO:0006468 protein phosphorylation
• GO:0016310 phosphorylation
• GO:0043484 regulation of RNA splicing

Cellular Component

• GO:0005634 nucleus

External links

• PDB: RCSB:6khd, PDBe:6khd, PDBj:6khd
• PDBsum: 6khd
• PubMed: 31531359
• UniProt: P49759|CLK1_HUMAN Dual specificity protein kinase CLK1 (Gene Name=CLK1)