Structure of PDB 6ke3 Chain A

Receptor sequence

>6ke3A (length=335) Species: 9606 (Homo sapiens)

GVQTVTLIPGDGIGPEISAAVMKIFDAAKAPIQWEERNVTAIQGPGGKWM
IPSEAKESMDKNKMGLKGPLKTPIAAGHPSMNLLLRKTFDLYANVRPCVS
IEGYKTPYTDVNIVTIRENTEGEYSGIEHVIVDGVVQSIKLITEGASKRI
AEFAFEYARNNHRSNVTAVHKANIMRMSDGLFLQKCREVAESCKDIKFNE
MYLDTVCLNMVQDPSQFDVLVMPNLYGDILSDLCAGLIGGLGVTPSGNIG
ANGVAIFESVHGTAPDIAGKDMANPTALLLSAVMMLRHMGLFDHAARIEA
ACFATIKDGKSLTKDLGGNAKCSDFTEEICRRVKD

3D structure

• PDB: 6ke3 Molecular basis for the function of the alpha beta heterodimer of human NAD-dependent isocitrate dehydrogenase.
• Chain: A
• Resolution: 3.307 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): Y126 K173 D206 D230
• Catalytic site (residue number reindexed from 1): Y124 K171 D204 D228
• Enzyme Commision number: 1.1.1.41: isocitrate dehydrogenase (NAD(+)).

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	NAI	A	N84 L243 H263 G264 T265 A266 D268 I269	N82 L241 H261 G262 T263 A264 D266 I267

Gene Ontology

Molecular Function

• GO:0000287 magnesium ion binding
• GO:0004449 isocitrate dehydrogenase (NAD+) activity
• GO:0005515 protein binding
• GO:0016491 oxidoreductase activity
• GO:0016616 oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor
• GO:0046872 metal ion binding
• GO:0051287 NAD binding

Biological Process

• GO:0005975 carbohydrate metabolic process
• GO:0006099 tricarboxylic acid cycle
• GO:0006102 isocitrate metabolic process

Cellular Component

• GO:0005634 nucleus
• GO:0005739 mitochondrion
• GO:0005759 mitochondrial matrix
• GO:0045242 isocitrate dehydrogenase complex (NAD+)

External links

• PDB: RCSB:6ke3, PDBe:6ke3, PDBj:6ke3
• PDBsum: 6ke3
• PubMed: 31515270
• UniProt: P50213|IDH3A_HUMAN Isocitrate dehydrogenase [NAD] subunit alpha, mitochondrial (Gene Name=IDH3A)